PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10012056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family G2-like
Protein Properties Length: 380aa    MW: 42082.9 Da    PI: 7.0008
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10012056genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33.1e-32238293156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+ eLH+rFv+a++qLGGs+ AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  Lus10012056 238 KQRRCWSAELHRRFVNALQQLGGSQAATPKQIREIMQVDGLTNDEVKSHLQKYRLH 293
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.518235295IPR017930Myb domain
SuperFamilySSF466891.08E-17236296IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-29236297IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-27238293IPR006447Myb domain, plants
PfamPF002495.0E-7240291IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MDSVAPSELS FDSRTVSAKT MRNILLQNSP PPPAIGDSAA ANKVDSLLSE LQAEVTKIDS  60
FRNQLPLSML LLTDAIAAVK EWIDSSAGKK QKQVPVLEEF IPLKKSCGDD EDKECRVEEE  120
IKDSSKDKRS WMSSVQLWSS DDSVAAKRNP GLESKENKKG NGCRNEDAFS RKLKIEENGG  180
RDEDLGVPDL SLLTPGMKNF VEEFIATNSS RRVSQSDSQS DVRVVPHHHQ SPLQGSRKQR  240
RCWSAELHRR FVNALQQLGG SQAATPKQIR EIMQVDGLTN DEVKSHLQKY RLHTRRMTSA  300
PANQSLVVLG GGLWMSSQEQ HRECSKAASS QSNSPQGPLQ FSRTLTGGDS MEDDHEDDAK  360
SENYNSWKCH TQRPGRVGV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010999925.11e-102PREDICTED: uncharacterized protein LOC105107622
TrEMBLA9PFU21e-102A9PFU2_POPTR; Putative uncharacterized protein
STRINGPOPTR_0004s15220.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-46G2-like family protein